Shenzhen Simeiquan Biotechnology Co., Ltd.

Pemasok Hormon Steroid Profesional dari Cina

Penjualan & dukungan
Quote request suatu -
Select Language
Rumah
Produk
Tentang kita
Wisata pabrik
Kontrol kualitas
Hubungi kami
Quote request suatu
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
RumahProduk

Bedak Pertumbuhan Rambut

Saya telah menerima produk saya, pengepakan Anda dilakukan dengan bijaksana dan sempurna, itu benar-benar membuat saya takjub. Saya akan memesan lebih banyak dari Anda sesegera mungkin. Tks!

—— Robet--Australia

Saya telah bekerja sama dengan Anda berkali-kali, kualitas produk Anda sangat bagus, itu sebabnya saya masih membeli produk dari Anda. Terima kasih

—— Richard---American

Hai sobat, harga terbaik dan produk dengan kemurnian tinggi sangat kompetitif di negara saya, ini biarkan saya menghasilkan banyak keuntungan, pelanggan saya benar-benar menyukainya.

—— Johnson---Canada

I 'm Online Chat Now

Bedak Pertumbuhan Rambut

(115)
Cina 99,5% Kemurnian Tinggi Minoxidil USP34 Pertumbuhan Rambut Powder Pharmaceutical CAS 38304-91-5 distributor

99,5% Kemurnian Tinggi Minoxidil USP34 Pertumbuhan Rambut Powder Pharmaceutical CAS 38304-91-5

99,5% Kemurnian Tinggi Minoxidil USP34 Pertumbuhan Rambut Powder Pharmaceutical CAS 38304-91-5 Detail Cepat: Minoxidil atau Minoxidil sulfat adalah jenis hipotensi, mengurangi tekanan darah, Mempromosikan ...    Baca lebih lanjut
2019-03-13 17:06:34
Cina BPH Bedak Pertumbuhan Rambut Avodart / Dutasteride 164656-23-9 Duagen distributor

BPH Bedak Pertumbuhan Rambut Avodart / Dutasteride 164656-23-9 Duagen

BPH Bedak Pertumbuhan Rambut Avodart / Dutasteride 164656-23-9 Duagen Dutasteride (Avodart) Nama produk: Dutasteride Berat Molekul: L28.5297 InChI: nChI = 1 / C27H30F6N2O2 / c1-24-11-9-17-15 (4-8-21-25 (17,2) ...    Baca lebih lanjut
2019-03-13 17:06:29
Cina Lyophilized Suntikkan 2mg / vial Pertumbuhan Rambut Steroid Sermorelin Polypeptide distributor

Lyophilized Suntikkan 2mg / vial Pertumbuhan Rambut Steroid Sermorelin Polypeptide

Lyophilized Suntikkan 2mg / vial Pertumbuhan Rambut Steroid Sermorelin Polypeptide Detail Cepat: Nama Produk: Sermorelin Sinonim: SERMORELIN; SERMORELIN ASETAT; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; TYR-ALA-ASP...    Baca lebih lanjut
2019-03-13 17:06:33
Cina Bubuk Pertumbuhan Rambut Hongdenafil Oral Kristal Putih CAS 98319-26-7 distributor

Bubuk Pertumbuhan Rambut Hongdenafil Oral Kristal Putih CAS 98319-26-7

Bubuk Pertumbuhan Rambut Hongdenafil Oral Kristal putih CAS 98319-26-7 Detail Cepat: Nama Produk Hongdenafil Nama lain Acetildenafil Nomor register CAS 831217-01-7 Formula molekul C25H34N6O3 Berat molekul 466...    Baca lebih lanjut
2019-03-13 17:06:25
Cina Afrodisiak Peptida Pertumbuhan Rambut Putih Steroid PT141 Asetat CAS 32780-32-8 distributor

Afrodisiak Peptida Pertumbuhan Rambut Putih Steroid PT141 Asetat CAS 32780-32-8

Afrodisiak Peptida Pertumbuhan Rambut Putih Steroid PT141 Asetat CAS 32780-32-8 Detail Cepat: Bremelanotide; PT-141 No CAS .: 32780-32-8 MOQ: 20 Botol Purity (HPLC): min 98,0%. Formula Molekul: C50H68N14O10 ...    Baca lebih lanjut
2019-03-13 17:06:27
Cina Kesehatan 99% Pertumbuhan Rambut Bubuk Dutasteride Avodart Anti-estrogen Steroid distributor

Kesehatan 99% Pertumbuhan Rambut Bubuk Dutasteride Avodart Anti-estrogen Steroid

Kesehatan 99% Pertumbuhan Rambut Bubuk Dutasteride Avodart Anti-estrogen Steroid Detail Cepat: Nama produk; Dutasteride Alias; Avodart CAS No.164656-23-9 Rumus molekul; C27H30F6N2O2 Berat molekul; 528,53 ...    Baca lebih lanjut
2019-03-13 17:06:20
Cina Putih Kristal Padat Pertumbuhan Rambut Steroid Finasteride Proscar Anti-estrogen Steroid distributor

Putih Kristal Padat Pertumbuhan Rambut Steroid Finasteride Proscar Anti-estrogen Steroid

Putih Kristal Padat Pertumbuhan Rambut Steroid Finasteride Proscar Anti-estrogen Steroid Detail Cepat: Nama produk: Finasteride Alias: Proscar CAS: 98319-26-7 MF: C23H36N2O2 MW: 372.55 Kemurnian: 99,68% ...    Baca lebih lanjut
2019-03-13 17:06:20
Cina 98319-26-7 Bedak Pertumbuhan Rambut Finasteride Propecia Mengobati Rambut Rontok distributor

98319-26-7 Bedak Pertumbuhan Rambut Finasteride Propecia Mengobati Rambut Rontok

98319-26-7 Bedak Pertumbuhan Rambut Finasteride Propecia Mengobati Rambut Rontok Detail Cepat: nama Produk Finasteride Nomor Pendaftaran CAS 98319-26-7 Formula molekul C23H36N2O2 Berat molekul 372.5441 InChI : ...    Baca lebih lanjut
2019-03-13 17:06:02
Cina Ekstrak Herbal Ampuh Pertumbuhan Rambut Steroid Minoxidil CAS 38304-91-5 distributor

Ekstrak Herbal Ampuh Pertumbuhan Rambut Steroid Minoxidil CAS 38304-91-5

Ekstrak Herbal Ampuh Pertumbuhan Rambut Steroid Minoxidil CAS 38304-91-5 Yang terhormat, SMQ telah mengekspornya produk selama 12 tahun, berkualitas tinggi dengan harga bagus dan respons cepat , selamat datang ...    Baca lebih lanjut
2019-03-13 17:06:09
Cina Powder Pertumbuhan Rambut Alami 57-85-2 Bubuk Testoviron Testosteron Propionate distributor

Powder Pertumbuhan Rambut Alami 57-85-2 Bubuk Testoviron Testosteron Propionate

Bubuk Pertumbuhan Rambut Alami 57-85-2 Bubuk Testoviron Testosteron Propionate 1. Detail Cepat: Nama bahasa Inggris: Testosteron Propionate Nama Bahasa Inggris: 17beta- (Propionyloxy) androst-4-en-3-one; 17beta...    Baca lebih lanjut
2019-03-13 17:06:15
Page 1 of 12 |< << 1  2  3  4  5  6  7  8  9  10  >> >|